PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v0616270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YB
Protein Properties Length: 119aa    MW: 13310.1 Da    PI: 4.7786
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v0616270.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB178.55.9e-5622114294
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                      reqdrflP+an+srimkk lPan+ki+kdaketvqecvsefisfvtseasdkcqrekrktingddllwa+atlGfe+y++plk+yl+ yre+e
  Lj5g3v0616270.1  22 REQDRFLPVANISRIMKKGLPANGKIAKDAKETVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEEYIDPLKLYLAAYREIE 114
                      89*****************************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.0E-5118114IPR009072Histone-fold
SuperFamilySSF471136.52E-3824113IPR009072Histone-fold
PfamPF008089.0E-282791IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.0E-205573No hitNo description
PROSITE patternPS0068505874IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.0E-207492No hitNo description
PRINTSPR006153.0E-2093111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MADAPASPPD ESGDHSPRSS FREQDRFLPV ANISRIMKKG LPANGKIAKD AKETVQECVS  60
EFISFVTSEA SDKCQREKRK TINGDDLLWA MATLGFEEYI DPLKLYLAAY REIEVILNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-4820112193NF-YB
4awl_B3e-4820112294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-4820112294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.224950.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015969981.12e-70PREDICTED: nuclear transcription factor Y subunit B-10-like
RefseqXP_015969982.12e-70PREDICTED: nuclear transcription factor Y subunit B-10-like
RefseqXP_016207962.12e-70PREDICTED: nuclear transcription factor Y subunit B-10-like
SwissprotQ8VYK42e-63NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLU5TZK51e-69U5TZK5_PHAVU; Nuclear transcription factor Y subunit B-10
STRINGGLYMA03G33490.16e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.31e-64nuclear factor Y, subunit B8